KARS Antibody - C-terminal region : FITC (ARP40589_P050-FITC)

Catalog No: ARP40589_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB, IHC
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KARS
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Guinea Pig: 85%; Horse: 88%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KARS (ARP40589_P050-FITC) antibody is Catalog # AAP40589 (Previous Catalog # AAPP22349)
• Sample Type Confirmation:

  KARS is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Halwani,R., (2004) J. Virol. 78 (14), 7553-7564

Target Info

• Gene Symbol: KARS
• Gene Full Name: Lysyl-tRNA synthetase
• Alias Symbols: KRS, KARS, KARS2, LEPID, CMTRIB, DEAPLE, DFNB89
• NCBI Gene Id: 3735
• Protein Name: Lysine--tRNA ligase
• Description of Target: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis.
• Uniprot ID: Q15046
• Protein Accession #: NP_005539
• Nucleotide Accession #: NM_005548
• Protein Size (# AA): 597
• Molecular Weight: 66kDa
• Protein Interactions: AIMP2; SUMO2; SUMO3; MDM2; UBC; SUMO1; NEDD8; STAT1; SSB; RPL21; RPL19; RPL17; NAP1L4; HSPA4; GPX1; CARS; APEH; CAND1; RANBP6; RPL36; JMJD6; NUDC; IPO7; AIMP1; SH3RF2; FBXO6; vpr; MSK1; gag; FN1; TRMT1; MRPS18B; UBE2S; CCT8; EEF1E1; VBP1; UBA1; RARS; QARS