Search Antibody, Protein, and ELISA Kit Solutions

KARS Antibody - C-terminal region (ARP40589_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40589_P050-FITC Conjugated

ARP40589_P050-HRP Conjugated

ARP40589_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Lysyl-tRNA synthetase
NCBI Gene Id:
Protein Name:
Lysine--tRNA ligase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-170764 from Santa Cruz Biotechnology.
Description of Target:
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KARS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KARS.
The immunogen is a synthetic peptide directed towards the C terminal region of human KARS
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Guinea Pig: 85%; Horse: 88%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 86%; Rat: 86%
Complete computational species homology data:
Anti-KARS (ARP40589_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KARS (ARP40589_P050) antibody is Catalog # AAP40589 (Previous Catalog # AAPP22349)
Printable datasheet for anti-KARS (ARP40589_P050) antibody
Sample Type Confirmation:

KARS is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Halwani,R., (2004) J. Virol. 78 (14), 7553-7564

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...