Karasurin-C Recombinant Protein (Chinese snake gourd) (OPCA02884)

Catalog No: OPCA02884

Karasurin-C Recombinant Protein (Trichosanthes kirilowii) (OPCA02884) in SDS-PAGE showing the molecular weight of approximately 29.4 kDa.

Product Info

• Predicted Species Reactivity: Trichosanthes kirilowii
• Product Format: Liquid or Lyophilized powder
• Host: Trichosanthes kirilowii
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
• Protein Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 22-270 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Amino acid sequences and ribosome-inactivating activities of karasurin-B and karasurin-C.Kondo T., Mizukami H., Takeda T., Ogihara Y. Biol. Pharm. Bull. 19:1485-1489(1996)
• Alias Symbols: rRNA N-glycosidase.
• Protein Name: Ribosome-inactivating protein karasurin-C
• Description of Target: Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits.
• Uniprot ID: P24478
• Protein Size (# AA): Recombinant
• Molecular Weight: 29.4 kDa