Search Antibody, Protein, and ELISA Kit Solutions

KALRN Antibody - middle region (ARP81502_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
KALRN
Official Gene Full Name:
kalirin, RhoGEF kinase
NCBI Gene Id:
8997
Protein Name:
kalirin
Swissprot Id:
O60229-5
Protein Accession #:
NP_001019831.2
Nucleotide Accession #:
NM_001024660.3
Alias Symbols:
DUO, CHD5, DUET, TRAD, CHDS5, HAPIP, ARHGEF24
Description of Target:
Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein that interacts with the huntingtin-associated protein 1, which is a huntingtin binding protein that may function in vesicle trafficking. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Size (# AA):
738
Molecular Weight:
81 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KALRN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KALRN.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human KALRN
Peptide Sequence:
Synthetic peptide located within the following region: GRKSFDLGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKI
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KALRN (ARP81502_P050) antibody is Catalog # AAP81502
Datasheets/Manuals:
Printable datasheet for anti-KALRN (ARP81502_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...