Catalog No: ARP31303_P050
Price: $0.00
SKU
ARP31303_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Jund (ARP31303_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: SPDLGLLKLASPELERLIIQSNGLVTTTPTSTQFLYPKVAASEEQEFAEG
Concentration0.5 mg/ml
Blocking PeptideFor anti-Jund (ARP31303_P050) antibody is Catalog # AAP31303 (Previous Catalog # AAPP02052)
Gene SymbolJund
Gene Full NameJun D proto-oncogene
Alias SymbolsMGC72300
NCBI Gene Id24518
Protein NameTranscription factor jun-D
Description of TargetThe protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. It has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternate translation initiation site usage, including non-AUG codons, results in the production of different isoforms.
Uniprot IDP52909
Protein Accession #NP_620230
Nucleotide Accession #NM_138875
Protein Size (# AA)341
Molecular Weight37kDa
  1. What is the species homology for "Jund Antibody - N-terminal region (ARP31303_P050)"?

    The tested species reactivity for this item is "Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig".

  2. How long will it take to receive "Jund Antibody - N-terminal region (ARP31303_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Jund Antibody - N-terminal region (ARP31303_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Jund Antibody - N-terminal region (ARP31303_P050)"?

    This target may also be called "MGC72300" in publications.

  5. What is the shipping cost for "Jund Antibody - N-terminal region (ARP31303_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Jund Antibody - N-terminal region (ARP31303_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Jund Antibody - N-terminal region (ARP31303_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Jund Antibody - N-terminal region (ARP31303_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "JUND"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "JUND"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "JUND"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "JUND"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "JUND"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "JUND"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Jund Antibody - N-terminal region (ARP31303_P050)
Your Rating
We found other products you might like!