Loading...
Catalog No: P100946_T100
Price: $0.00
SKU
P100946_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-JUNB (P100946_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human JUNB
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSL
Concentration1.0 mg/ml
Blocking PeptideFor anti-JUNB (P100946_T100) antibody is Catalog # AAP31301 (Previous Catalog # AAPP02050)
ReferenceTroen,G., (2004) J Mol Diagn 6 (4), 297-307
Description
Gene SymbolJUNB
Gene Full NameJun B proto-oncogene
Alias SymbolsAP-1
NCBI Gene Id3726
Protein NameTranscription factor jun-B
Description of TargetThe c-Jun proto-oncogene was first identified as the cellular homolog of the avian sarcoma virus v-Jun oncogene. The c-Jun protein, along with c-Fos, is a component of the AP-1 transcriptional complex. c-Jun can form either Jun/Jun homodimers or Jun/Fos heterodimers via the leucine repeats in both proteins. Jun B and Jun D, have been shown to be almost identical to c-Jun in their C-terminal regions, which are involved in dimerization and DNA binding, whereas their N-terminal domains, which are involved in transcriptional activation, diverge. JunB is involved in many types of human carcinoma including T-cell lymphomas, CML,primary cutaneous lymphomas. Aberrantly expressed c-Jun and JunB are a hallmark of Hodgkin lymphoma cells, stimulate proliferation and synergize with NF-kappa B. JunB potentiates function of BRCA1 activation domain 1 (AD1) through a coiled-coil-mediated interaction.JunB is an important regulator of erythroid Differentiation.
Uniprot IDP17275
Protein Accession #NP_002220
Nucleotide Accession #NM_002229
Protein Size (# AA)347
Molecular Weight36kDa
Protein InteractionsBATF; FOS; RFWD2; C19orf68; USP24; TCERG1; ZNF595; PKIA; MAP2; APLP2; FOSL1; DDIT3; ATF3; BATF2; BATF3; TCL1A; FOSL2; NPM1; NEU1; SMAD4; HOXA7; BDNF; ATF4; MAPK6; UBC; TDG; SET; SAT1; MAPK9; BRCA1; SUMO2; Cebpb; EP300; SMURF1; YY1; CREBBP; SMARCA4; JDP2;
  1. What is the species homology for "JUNB Antibody - N-terminal region (P100946_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish".

  2. How long will it take to receive "JUNB Antibody - N-terminal region (P100946_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "JUNB Antibody - N-terminal region (P100946_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "JUNB Antibody - N-terminal region (P100946_T100)"?

    This target may also be called "AP-1" in publications.

  5. What is the shipping cost for "JUNB Antibody - N-terminal region (P100946_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "JUNB Antibody - N-terminal region (P100946_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "JUNB Antibody - N-terminal region (P100946_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "JUNB Antibody - N-terminal region (P100946_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "JUNB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "JUNB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "JUNB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "JUNB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "JUNB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "JUNB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:JUNB Antibody - N-terminal region (P100946_T100)
Your Rating
We found other products you might like!