Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP89035_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

JUNB Antibody - middle region (ARP89035_P050)

Catalog#: ARP89035_P050
Domestic: within 24 hours delivery International: 3-5 business days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle terminal region of mouse JUNB
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: VPNSNGVITTTPTPPGQYFYPRGGGSGGGTGGGVTEEQEGFADGFVKALD
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-JUNB (ARP89035_P050) antibody is Catalog # AAP89035
Datasheets/ManualsPrintable datasheet for anti-JUNB (ARP89035_P050) antibody
Gene SymbolJUNB
Official Gene Full Namejun B proto-oncogene
NCBI Gene Id16477
Protein Nametranscription factor jun-B
Description of TargetTranscription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGA[CG]TCA-3'.
Swissprot IdP09450
Protein Accession #NP_032442.1
Nucleotide Accession #NM_008416.3
Protein Size (# AA)344
Molecular Weight37 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express JUNB.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express JUNB.
Write Your Own Review
You're reviewing:JUNB Antibody - middle region (ARP89035_P050)
Your Rating
Aviva Travel Grant
Aviva Live Chat
Aviva Tissue Tool
Aviva HIS tag Deal