Search Antibody, Protein, and ELISA Kit Solutions

JUNB Antibody - middle region (ARP89035_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse JUNB
Purification:
Affinity purified
Peptide Sequence:
Synthetic peptide located within the following region: VPNSNGVITTTPTPPGQYFYPRGGGSGGGTGGGVTEEQEGFADGFVKALD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-JUNB (ARP89035_P050) antibody is Catalog # AAP89035
Datasheets/Manuals:
Printable datasheet for anti-JUNB (ARP89035_P050) antibody
Gene Symbol:
JUNB
Official Gene Full Name:
jun B proto-oncogene
NCBI Gene Id:
16477
Protein Name:
transcription factor jun-B
Description of Target:
Transcription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGA[CG]TCA-3'.
Swissprot Id:
P09450
Protein Accession #:
NP_032442.1
Nucleotide Accession #:
NM_008416.3
Protein Size (# AA):
344
Molecular Weight:
37 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express JUNB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express JUNB.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...