Search Antibody, Protein, and ELISA Kit Solutions

JUN antibody - N-terminal region (P100911_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100911_P050-FITC Conjugated

P100911_P050-HRP Conjugated

P100911_P050-Biotin Conjugated

Gene Symbol:
JUN
NCBI Gene Id:
3725
Official Gene Full Name:
Jun proto-oncogene
Protein Name:
Transcription factor AP-1
Swissprot Id:
P05412
Protein Accession #:
NP_002219
Nucleotide Accession #:
NM_002228
Alias Symbols:
AP1, c-Jun, AP-1
Replacement Item:
This antibody may replace item sc-110019 from Santa Cruz Biotechnology.
Description of Target:
JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
331
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
CHIP, IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express JUN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express JUN.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human JUN
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Sheep: 92%
Complete computational species homology data:
Anti-JUN (P100911_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PPP3CA; SP1; HDAC1; GSK3B; FOS; ABL1; MAPK8; RFWD2; CORO7; EP300; STRN4; MAPRE3; CREB3; PRRC2A; MDM2; SMAD2; HSP90AA1; HSPA8; ATF2; APP; APLP2; GOPC; BBS7; ETS1; CREBBP; CASP9; UBC; NCOR1; EPAS1; DDIT3; BATF2; BATF3; BATF; FOSL1; SMARCD3; CEBPG; CEBPE; AT
Blocking Peptide:
For anti-JUN (P100911_P050) antibody is Catalog # AAP31260 (Previous Catalog # AAPP02009)
Datasheets/Manuals:
Printable datasheet for anti-JUN (P100911_P050) antibody
Sample Type Confirmation:

JUN is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Adiseshaiah,P., (2008) Biochem. Biophys. Res. Commun. 371 (2), 304-308
Publications:

Russo, R. et al. The newly characterized Pl-jun is specifically expressed in skeletogenic cells of the Paracentrotus lividus sea urchin embryo. FEBS J. 281, 3828-43 (2014). CHIP, IHC, WB, Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep 25040505

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...