Catalog No: P100911_P050
Price: $0.00
SKU
P100911_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-JUN (P100911_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationCHIP, IHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human JUN
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Sheep: 92%
Peptide SequenceSynthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP
Concentration0.5 mg/ml
Blocking PeptideFor anti-JUN (P100911_P050) antibody is Catalog # AAP31260 (Previous Catalog # AAPP02009)
Sample Type Confirmation

JUN is strongly supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceAdiseshaiah,P., (2008) Biochem. Biophys. Res. Commun. 371 (2), 304-308
Publications

Russo, R. et al. The newly characterized Pl-jun is specifically expressed in skeletogenic cells of the Paracentrotus lividus sea urchin embryo. FEBS J. 281, 3828-43 (2014). 25040505

Description
Gene SymbolJUN
Gene Full NameJun proto-oncogene
Alias SymbolsAP1, p39, AP-1, cJUN, c-Jun
NCBI Gene Id3725
Protein NameTranscription factor AP-1
Description of TargetJUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP05412
Protein Accession #NP_002219
Nucleotide Accession #NM_002228
Protein Size (# AA)331
Molecular Weight36kDa
Protein InteractionsPPP3CA; SP1; HDAC1; GSK3B; FOS; ABL1; MAPK8; RFWD2; CORO7; EP300; STRN4; MAPRE3; CREB3; PRRC2A; MDM2; SMAD2; HSP90AA1; HSPA8; ATF2; APP; APLP2; GOPC; BBS7; ETS1; CREBBP; CASP9; UBC; NCOR1; EPAS1; DDIT3; BATF2; BATF3; BATF; FOSL1; SMARCD3; CEBPG; CEBPE; AT
  1. What is the species homology for "JUN Antibody - N-terminal region (P100911_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Pig, Rabbit, Sheep".

  2. How long will it take to receive "JUN Antibody - N-terminal region (P100911_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "JUN Antibody - N-terminal region (P100911_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "JUN Antibody - N-terminal region (P100911_P050)"?

    This target may also be called "AP1, p39, AP-1, cJUN, c-Jun" in publications.

  5. What is the shipping cost for "JUN Antibody - N-terminal region (P100911_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "JUN Antibody - N-terminal region (P100911_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "JUN Antibody - N-terminal region (P100911_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "JUN Antibody - N-terminal region (P100911_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "JUN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "JUN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "JUN"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "JUN"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "JUN"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "JUN"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:JUN Antibody - N-terminal region (P100911_P050)
Your Rating
We found other products you might like!