Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

JUN Antibody - N-terminal region : FITC (P100911_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100911_P050 Unconjugated

P100911_P050-HRP Conjugated

P100911_P050-Biotin Conjugated

Gene Symbol:
JUN
Official Gene Full Name:
Jun proto-oncogene
NCBI Gene Id:
3725
Protein Name:
Transcription factor AP-1
Swissprot Id:
P05412
Protein Accession #:
NP_002219
Nucleotide Accession #:
NM_002228
Alias Symbols:
AP1, c-Jun, AP-1
Replacement Item:
This antibody may replace item sc-110019 from Santa Cruz Biotechnology.
Description of Target:
JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
331
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
CHIP, IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express JUN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express JUN.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human JUN
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Sheep: 92%
Complete computational species homology data:
Anti-JUN (P100911_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
PPP3CA; SP1; HDAC1; GSK3B; FOS; ABL1; MAPK8; RFWD2; CORO7; EP300; STRN4; MAPRE3; CREB3; PRRC2A; MDM2; SMAD2; HSP90AA1; HSPA8; ATF2; APP; APLP2; GOPC; BBS7; ETS1; CREBBP; CASP9; UBC; NCOR1; EPAS1; DDIT3; BATF2; BATF3; BATF; FOSL1; SMARCD3; CEBPG; CEBPE; AT
Blocking Peptide:
For anti-JUN (P100911_P050-FITC) antibody is Catalog # AAP31260 (Previous Catalog # AAPP02009)
Datasheets/Manuals:
Printable datasheet for anti-JUN (P100911_P050-FITC) antibody
Sample Type Confirmation:

JUN is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Adiseshaiah,P., (2008) Biochem. Biophys. Res. Commun. 371 (2), 304-308
Publications:

Russo, R. et al. The newly characterized Pl-jun is specifically expressed in skeletogenic cells of the Paracentrotus lividus sea urchin embryo. FEBS J. 281, 3828-43 (2014). WB, IHC, Bovine, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep 25040505

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...