Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP30926_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30926_P050-FITC Conjugated

ARP30926_P050-HRP Conjugated

ARP30926_P050-Biotin Conjugated

JUN Antibody - middle region (ARP30926_P050)

Rating:
80% of 100
Catalog#: ARP30926_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse, Sea Urchin
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-110019 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 100%
Complete computational species homology dataAnti-JUN (ARP30926_P050)
Peptide SequenceSynthetic peptide located within the following region: QHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAAS
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-JUN (ARP30926_P050) antibody is Catalog # AAP30926
Datasheets/ManualsPrintable datasheet for anti-JUN (ARP30926_P050) antibody
Gene SymbolJUN
Official Gene Full NameJun proto-oncogene
Alias SymbolsAP-1, AP1, c-Jun
NCBI Gene Id3725
Protein NameTranscription factor AP-1
Description of TargetJUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
Swissprot IdP05412
Protein Accession #NP_002219
Nucleotide Accession #NM_002228
Protein Size (# AA)331
Molecular Weight36kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express JUN.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express JUN.
Protein InteractionsPPP3CA; SP1; HDAC1; GSK3B; FOS; ABL1; MAPK8; RFWD2; CORO7; EP300; STRN4; MAPRE3; CREB3; PRRC2A; MDM2; SMAD2; HSP90AA1; HSPA8; ATF2; APP; APLP2; GOPC; BBS7; ETS1; CREBBP; CASP9; UBC; NCOR1; EPAS1; DDIT3; BATF2; BATF3; BATF; FOSL1; SMARCD3; CEBPG; CEBPE; AT
Write Your Own Review
You're reviewing:JUN Antibody - middle region (ARP30926_P050)
Your Rating
Aviva Live Chat
Aviva Pathways
Aviva Tips and Tricks
Aviva ChIP Antibodies