JMJD6 Antibody - C-terminal region (ARP90685_P050)

Catalog No: ARP90685_P050

Host: Rabbit
Target Name: JMJD6
Sample Tissue: Mouse Stomach lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse JMJD6
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: WYRILKQEHPELAVLADAVDLQESTGIASDSSSDSSSSSSSSSSDSDSEC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-JMJD6 (ARP90685_P050) antibody is Catalog # AAP90685

Target Info

• Gene Symbol: JMJD6
• Gene Full Name: jumonji domain containing 6
• Alias Symbols: Pt, PSR, Ptd, Ptdsr, PtdSerR, mKIAA0585, D11Ertd195e, 5730436I23Rik
• NCBI Gene Id: 107817
• Protein Name: bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
• Description of Target: This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein functions in differentiation of multiple tissues during development, and in anti-inflammatory cytokine signaling. It was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that this protein does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor.
• Uniprot ID: Q9ERI5
• Protein Accession #: NP_203971.2
• Nucleotide Accession #: NM_033398.2
• Protein Size (# AA): 403
• Molecular Weight: 46 kDa