Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58120_P050-FITC Conjugated

ARP58120_P050-HRP Conjugated

ARP58120_P050-Biotin Conjugated

JMJD5 Antibody - middle region (ARP58120_P050)

Catalog#: ARP58120_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application CHIP, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human JMJD5
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-JMJD5 (ARP58120_P050)
Peptide Sequence Synthetic peptide located within the following region: LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KDM8 (ARP58120_P050) antibody is Catalog # AAP58120 (Previous Catalog # AAPP32553)
Datasheets/Manuals Printable datasheet for anti-KDM8 (ARP58120_P050) antibody
Target Reference Imataka,H., (2007) Nat. Rev. Genet. 8 (11), 829-833
Gene Symbol KDM8
Official Gene Full Name Lysine (K)-specific demethylase 8
Alias Symbols FLJ13798, JMJD5
NCBI Gene Id 79831
Protein Name Lysine-specific demethylase 8
Description of Target JMJD5 is a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor.JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]).[supplied by OMIM].
Swissprot Id Q8N371
Protein Accession # NP_079049
Nucleotide Accession # NM_024773
Protein Size (# AA) 416
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express JMJD5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express JMJD5.
Protein Interactions PCYT2;
  1. What is the species homology for "JMJD5 Antibody - middle region (ARP58120_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "JMJD5 Antibody - middle region (ARP58120_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "JMJD5 Antibody - middle region (ARP58120_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "JMJD5 Antibody - middle region (ARP58120_P050)"?

    This target may also be called "FLJ13798, JMJD5" in publications.

  5. What is the shipping cost for "JMJD5 Antibody - middle region (ARP58120_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "JMJD5 Antibody - middle region (ARP58120_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "JMJD5 Antibody - middle region (ARP58120_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "JMJD5 Antibody - middle region (ARP58120_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KDM8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KDM8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KDM8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KDM8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KDM8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KDM8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:JMJD5 Antibody - middle region (ARP58120_P050)
Your Rating
We found other products you might like!