Search Antibody, Protein, and ELISA Kit Solutions

JMJD5 Antibody - middle region (ARP58120_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58120_P050-FITC Conjugated

ARP58120_P050-HRP Conjugated

ARP58120_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
KDM8
Official Gene Full Name:
Lysine (K)-specific demethylase 8
NCBI Gene Id:
79831
Protein Name:
Lysine-specific demethylase 8
Swissprot Id:
Q8N371
Protein Accession #:
NP_079049
Nucleotide Accession #:
NM_024773
Alias Symbols:
FLJ13798, JMJD5
Description of Target:
JMJD5 is a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor.JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]).[supplied by OMIM].
Protein Size (# AA):
416
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
CHIP, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express JMJD5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express JMJD5.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human JMJD5
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-JMJD5 (ARP58120_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PCYT2;
Blocking Peptide:
For anti-KDM8 (ARP58120_P050) antibody is Catalog # AAP58120 (Previous Catalog # AAPP32553)
Datasheets/Manuals:
Printable datasheet for anti-KDM8 (ARP58120_P050) antibody
Target Reference:
Imataka,H., (2007) Nat. Rev. Genet. 8 (11), 829-833

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...