Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

JMJD2C Antibody - C-terminal region (ARP32974_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32974_P050-FITC Conjugated

ARP32974_P050-HRP Conjugated

ARP32974_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Lysine (K)-specific demethylase 4C
NCBI Gene Id:
Protein Name:
Lysine-specific demethylase 4C Ensembl ENSP00000445427
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ25949, GASC1, JHDM3C, JMJD2C, KIAA0780, bA146B14.1
Replacement Item:
This antibody may replace item sc-104949 from Santa Cruz Biotechnology.
Description of Target:
JMJD2C is a member of the Jumonji domain 2 (JMJD2) family. It contains one JmjC domain, one JmjN domain, two PHD-type zinc fingers, and two Tudor domains. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form. Chromosomal aberrations and increased transcriptional expression of this gene are associated with esophageal squamous cell carcinoma.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express JMJD2C.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express JMJD2C.
The immunogen is a synthetic peptide directed towards the middle region of human JMJD2C
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-JMJD2C (ARP32974_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KDM4C (ARP32974_P050) antibody is Catalog # AAP32974 (Previous Catalog # AAPP04002)
Printable datasheet for anti-KDM4C (ARP32974_P050) antibody

Lu, C. et al. IDH mutation impairs histone demethylation and results in a block to cell differentiation. Nature 483, 474-8 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22343901

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...