Size:100 ul
$319.00
In Stock
SKU
ARP32974_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32974_P050-FITC Conjugated

ARP32974_P050-HRP Conjugated

ARP32974_P050-Biotin Conjugated

JMJD2C Antibody - C-terminal region (ARP32974_P050)

Catalog#: ARP32974_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-104949 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human JMJD2C
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-JMJD2C (ARP32974_P050)
Peptide Sequence Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KDM4C (ARP32974_P050) antibody is Catalog # AAP32974 (Previous Catalog # AAPP04002)
Datasheets/Manuals Printable datasheet for anti-KDM4C (ARP32974_P050) antibody
Publications

Lu, C. et al. IDH mutation impairs histone demethylation and results in a block to cell differentiation. Nature 483, 474-8 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22343901

Gene Symbol KDM4C
Official Gene Full Name Lysine (K)-specific demethylase 4C
Alias Symbols FLJ25949, GASC1, JHDM3C, JMJD2C, KIAA0780, bA146B14.1
NCBI Gene Id 23081
Protein Name Lysine-specific demethylase 4C Ensembl ENSP00000445427
Description of Target JMJD2C is a member of the Jumonji domain 2 (JMJD2) family. It contains one JmjC domain, one JmjN domain, two PHD-type zinc fingers, and two Tudor domains. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form. Chromosomal aberrations and increased transcriptional expression of this gene are associated with esophageal squamous cell carcinoma.
Swissprot Id F5H347
Protein Accession # NP_001140167
Nucleotide Accession # NM_001146695
Protein Size (# AA) 813
Molecular Weight 92kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express JMJD2C.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express JMJD2C.
Protein Interactions UBC; HIST2H3C; HDAC3; PPARG; HDAC1; H3F3A; HIST1H3A; KDM4C; KDM4A;
  1. What is the species homology for "JMJD2C Antibody - C-terminal region (ARP32974_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "JMJD2C Antibody - C-terminal region (ARP32974_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "JMJD2C Antibody - C-terminal region (ARP32974_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "JMJD2C Antibody - C-terminal region (ARP32974_P050)"?

    This target may also be called "FLJ25949, GASC1, JHDM3C, JMJD2C, KIAA0780, bA146B14.1" in publications.

  5. What is the shipping cost for "JMJD2C Antibody - C-terminal region (ARP32974_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "JMJD2C Antibody - C-terminal region (ARP32974_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "JMJD2C Antibody - C-terminal region (ARP32974_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "92kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "JMJD2C Antibody - C-terminal region (ARP32974_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KDM4C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KDM4C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KDM4C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KDM4C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KDM4C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KDM4C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:JMJD2C Antibody - C-terminal region (ARP32974_P050)
Your Rating
We found other products you might like!