JMJD2B Antibody - middle region (ARP58398_P050)

Catalog No: ARP58398_P050

WB Suggested Anti-JMJD2B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JMJD2B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Horse: 92%; Human: 100%; Pig: 92%
• Peptide Sequence: Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KDM4B (ARP58398_P050) antibody is Catalog # AAP58398 (Previous Catalog # AAPP33407)

Target Info

• Reference: Katoh,Y. (2007) Int. J. Mol. Med. 20 (2), 269-273
• Gene Symbol: KDM4B
• Gene Full Name: Lysine (K)-specific demethylase 4B
• Alias Symbols: JMJD2B, TDRD14B
• NCBI Gene Id: 23030
• Protein Name: Lysine-specific demethylase 4B
• Description of Target: JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes. Human genes corresponding to KIAA0677, KIAA0876, KIAA0780 and FLJ10251 cDNAs were designated JMJD2A, JMJD2B, JMJD2C, and JMJD2D, respectively. In addition, JMJD2D homologous genes within human genome sequences AP002383.3 and AP001264.4 were designated JMJD2E and JMJD2F, respectively. C2HC2HC2- and C5HC2-type Cys (His) clusters were identified as the region conserved among JMJD2A (1064 aa), JMJD2B (1096 aa), and JMJD2C (1056 aa) proteins. JMJD2A, JMJD2B and JMJD2C consist of JmjN, JmjC, JD2H, and two TUDOR domains.
• Uniprot ID: O94953
• Protein Accession #: NP_055830
• Nucleotide Accession #: NM_015015
• Protein Size (# AA): 1096
• Molecular Weight: 122kDa
• Protein Interactions: UBC; H3F3C; HSP90B1; HSP90AA2P; SMU1; KMT2C; WDR5; ASH2L; KMT2D; RBBP5; HSPA4; HNRNPU; ESR1; MED10;