Size:100 ul
$229.00
In stock
SKU
ARP32911_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32911_T100-FITC Conjugated

ARP32911_T100-HRP Conjugated

ARP32911_T100-Biotin Conjugated

JMJD1A Antibody - C-terminal region (ARP32911_T100)

Catalog#: ARP32911_T100
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1A
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-JMJD1A (ARP32911_T100)
Peptide Sequence Synthetic peptide located within the following region: HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KDM3A (ARP32911_T100) antibody is Catalog # AAP32911 (Previous Catalog # AAPP03935)
Datasheets/Manuals Printable datasheet for anti-KDM3A (ARP32911_T100) antibody
Sample Type Confirmation

KDM3A is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Katoh,M. et al., (2003) Int. J. Mol. Med. 12 (5), 817-821
Publications

Zhou, X., Sun, H., Ellen, T. P., Chen, H. & Costa, M. Arsenite alters global histone H3 methylation. Carcinogenesis 29, 1831-6 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18321869

Gene Symbol KDM3A
Official Gene Full Name Lysine (K)-specific demethylase 3A
Alias Symbols TSGA, JMJD1, JHDM2A, JHMD2A, JMJD1A
NCBI Gene Id 55818
Protein Name Lysine-specific demethylase 3A
Description of Target JMJD1A is a zinc finger protein that contains a jumonji domain.
Swissprot Id Q53S72
Protein Accession # NP_060903
Nucleotide Accession # NM_018433
Protein Size (# AA) 1321
Molecular Weight 147kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express JMJD1A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express JMJD1A.
Protein Interactions RIPK2; HIST2H3C; CBX2; CBX4; AR; HIF1A; UBC; MYOCD; MKL1; MKL2; ETV2; TCEAL1;
Write Your Own Review
You're reviewing:JMJD1A Antibody - C-terminal region (ARP32911_T100)
Your Rating