Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

JMJD1A Antibody - C-terminal region (ARP32911_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32911_T100-FITC Conjugated

ARP32911_T100-HRP Conjugated

ARP32911_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Lysine (K)-specific demethylase 3A
NCBI Gene Id:
Protein Name:
Lysine-specific demethylase 3A
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
JMJD1A is a zinc finger protein that contains a jumonji domain.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express JMJD1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express JMJD1A.
The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1A
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-JMJD1A (ARP32911_T100)
Peptide Sequence:
Synthetic peptide located within the following region: HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KDM3A (ARP32911_T100) antibody is Catalog # AAP32911 (Previous Catalog # AAPP03935)
Printable datasheet for anti-KDM3A (ARP32911_T100) antibody
Sample Type Confirmation:

KDM3A is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Katoh,M. et al., (2003) Int. J. Mol. Med. 12 (5), 817-821

Zhou, X., Sun, H., Ellen, T. P., Chen, H. & Costa, M. Arsenite alters global histone H3 methylation. Carcinogenesis 29, 1831-6 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18321869

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...