Size:100 ul
$229.00
In Stock
SKU
ARP32911_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32911_T100-FITC Conjugated

ARP32911_T100-HRP Conjugated

ARP32911_T100-Biotin Conjugated

JMJD1A Antibody - C-terminal region (ARP32911_T100)

Catalog#: ARP32911_T100
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1A
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-JMJD1A (ARP32911_T100)
Peptide Sequence Synthetic peptide located within the following region: HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KDM3A (ARP32911_T100) antibody is Catalog # AAP32911 (Previous Catalog # AAPP03935)
Datasheets/Manuals Printable datasheet for anti-KDM3A (ARP32911_T100) antibody
Sample Type Confirmation

KDM3A is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Katoh,M. et al., (2003) Int. J. Mol. Med. 12 (5), 817-821
Publications

Zhou, X., Sun, H., Ellen, T. P., Chen, H. & Costa, M. Arsenite alters global histone H3 methylation. Carcinogenesis 29, 1831-6 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18321869

Gene Symbol KDM3A
Official Gene Full Name Lysine (K)-specific demethylase 3A
Alias Symbols TSGA, JMJD1, JHDM2A, JHMD2A, JMJD1A
NCBI Gene Id 55818
Protein Name Lysine-specific demethylase 3A
Description of Target JMJD1A is a zinc finger protein that contains a jumonji domain.
Swissprot Id Q53S72
Protein Accession # NP_060903
Nucleotide Accession # NM_018433
Protein Size (# AA) 1321
Molecular Weight 147kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express JMJD1A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express JMJD1A.
Protein Interactions RIPK2; HIST2H3C; CBX2; CBX4; AR; HIF1A; UBC; MYOCD; MKL1; MKL2; ETV2; TCEAL1;
  1. What is the species homology for "JMJD1A Antibody - C-terminal region (ARP32911_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "JMJD1A Antibody - C-terminal region (ARP32911_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "JMJD1A Antibody - C-terminal region (ARP32911_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "JMJD1A Antibody - C-terminal region (ARP32911_T100)"?

    This target may also be called "TSGA, JMJD1, JHDM2A, JHMD2A, JMJD1A" in publications.

  5. What is the shipping cost for "JMJD1A Antibody - C-terminal region (ARP32911_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "JMJD1A Antibody - C-terminal region (ARP32911_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "JMJD1A Antibody - C-terminal region (ARP32911_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "147kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "JMJD1A Antibody - C-terminal region (ARP32911_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KDM3A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KDM3A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KDM3A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KDM3A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KDM3A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KDM3A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:JMJD1A Antibody - C-terminal region (ARP32911_T100)
Your Rating
We found other products you might like!