Catalog No: ARP54306_P050
Price: $0.00
SKU
ARP54306_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

JAK3 Antibody - middle region (ARP54306_P050)

Datasheets/ManualsPrintable datasheet for anti-JAK3 (ARP54306_P050) antibody
Product Info
ReferenceCheng,H., (2008) Mol. Cell. Biol. 28 (7), 2271-2282
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human JAK3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF
Concentration0.5 mg/ml
Blocking PeptideFor anti-JAK3 (ARP54306_P050) antibody is Catalog # AAP54306 (Previous Catalog # AAPP31055)
Gene SymbolJAK3
Gene Full NameJanus kinase 3
Alias SymbolsJAKL, LJAK, JAK-3, L-JAK, JAK3_HUMAN
NCBI Gene Id3718
Protein NameTyrosine-protein kinase JAK3
Description of TargetJAK3 is a member of the Janus kinase (JAK) family of tyrosine kinases, which is involved in cytokine receptor-mediated intracellular signal transduction. JAK3 is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in JAK3 are associated with autosomal SCID (severe combined immunodeficiency disease).The protein encoded by this gene is a member of the Janus kinase (JAK) family of tyrosine kinases involved in cytokine receptor-mediated intracellular signal transduction. It is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in this gene are associated with autosomal SCID (severe combined immunodeficiency disease). Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP52333
Protein Accession #NP_000206
Nucleotide Accession #NM_000215
Protein Size (# AA)1124
Molecular Weight125kDa
Protein InteractionsSocs5; KIT; IL7R; TYK2; STAT6; STAT3; JAK2; JAK1; IL4R; GTF2B; ERBB3; CDK1; CD81; APOA1; UBC; SOCS3; UHRF2; STAT5A; IKBKG; ALK; SH2B2; TIAF1; INPP5D; PTPN2; STAM2; PRMT5; SOCS1; KHDRBS1; STAM; PTK2B; IRS2; SHB; JAK3; IL2RG; VIL1; FES; CD247; PTPN6; PIK3R1
  1. What is the species homology for "JAK3 Antibody - middle region (ARP54306_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig".

  2. How long will it take to receive "JAK3 Antibody - middle region (ARP54306_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "JAK3 Antibody - middle region (ARP54306_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "JAK3 Antibody - middle region (ARP54306_P050)"?

    This target may also be called "JAKL, LJAK, JAK-3, L-JAK, JAK3_HUMAN" in publications.

  5. What is the shipping cost for "JAK3 Antibody - middle region (ARP54306_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "JAK3 Antibody - middle region (ARP54306_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "JAK3 Antibody - middle region (ARP54306_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "125kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "JAK3 Antibody - middle region (ARP54306_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "JAK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "JAK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "JAK3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "JAK3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "JAK3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "JAK3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:JAK3 Antibody - middle region (ARP54306_P050)
Your Rating
We found other products you might like!