Search Antibody, Protein, and ELISA Kit Solutions

JAG2 antibody - N-terminal region (ARP45254_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45254_P050-FITC Conjugated

ARP45254_P050-HRP Conjugated

ARP45254_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Jagged 2
Protein Name:
Protein jagged-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-8157 from Santa Cruz Biotechnology.
Description of Target:
The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express JAG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express JAG2.
The immunogen is a synthetic peptide directed towards the N terminal region of human JAG2
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-JAG2 (ARP45254_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-JAG2 (ARP45254_P050) antibody is Catalog # AAP45254 (Previous Catalog # AAPY01222)
Printable datasheet for anti-JAG2 (ARP45254_P050) antibody
Target Reference:
Passos Schizophr. Res. 88 (1-3), 275-282 (2006)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...