Now Offering Over 102,157 Antibodies & 44,722 Antigens!

JAG2 antibody - N-terminal region (ARP45254_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP45254_P050-FITC Conjugated

ARP45254_P050-HRP Conjugated

ARP45254_P050-Biotin Conjugated

Gene Symbol:
JAG2
NCBI Gene Id:
3714
Official Gene Full Name:
Jagged 2
Protein Name:
Protein jagged-2
Swissprot Id:
Q9Y219
Protein Accession #:
NP_002217
Nucleotide Accession #:
NM_002226
Alias Symbols:
HJ2, SER2
Replacement Item:
This antibody may replace item sc-8157 from Santa Cruz Biotechnology.
Description of Target:
The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
1238
Molecular Weight:
130kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express JAG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express JAG2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human JAG2
Species Reactivity:
Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-JAG2 (ARP45254_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GFI1B; ATN1; ATXN7; CACNA1A; MIB2; NOTCH3; NOTCH2; NOTCH1;
Blocking Peptide:
For anti-JAG2 (ARP45254_P050) antibody is Catalog # AAP45254 (Previous Catalog # AAPY01222)
Datasheets/Manuals:
Printable datasheet for anti-JAG2 (ARP45254_P050) antibody
Target Reference:
Passos Schizophr. Res. 88 (1-3), 275-282 (2006)

Tell us what you think about this item!

Write A Review
    Please, wait...