Search Antibody, Protein, and ELISA Kit Solutions

JAG2 Antibody - N-terminal region (ARP45254_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP45254_P050-FITC Conjugated

ARP45254_P050-HRP Conjugated

ARP45254_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human, Mouse, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-8157 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human JAG2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-JAG2 (ARP45254_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-JAG2 (ARP45254_P050) antibody is Catalog # AAP45254 (Previous Catalog # AAPY01222)
Datasheets/Manuals:
Printable datasheet for anti-JAG2 (ARP45254_P050) antibody
Target Reference:
Passos Schizophr. Res. 88 (1-3), 275-282 (2006)
Gene Symbol:
JAG2
Official Gene Full Name:
Jagged 2
Alias Symbols:
HJ2, SER2
NCBI Gene Id:
3714
Protein Name:
Protein jagged-2
Description of Target:
The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot Id:
Q9Y219
Protein Accession #:
NP_002217
Nucleotide Accession #:
NM_002226
Protein Size (# AA):
1238
Molecular Weight:
130kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express JAG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express JAG2.
Protein Interactions:
GFI1B; ATN1; ATXN7; CACNA1A; MIB2; NOTCH3; NOTCH2; NOTCH1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...