IX Recombinant Protein (Bacteriophage M13) (OPCA04304)

Catalog No: OPCA04304

Product Info

• Predicted Species Reactivity: Enterobacteria phage M13
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Enterobacteria phage M13 (Bacteriophage M13)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
• Protein Sequence: MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-32 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd.van Wezenbeek P.M.G.F., Hulsebos T.J.M., Schoenmakers J.G.G.Gene 11:129-148(1980)
• Gene Symbol: IX
• Alias Symbols: Coat protein C, polypeptide II;G9P.
• NCBI Gene Id: 927332
• Protein Name: Tail virion protein G9P
• Description of Target: May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
• Uniprot ID: P69538
• Protein Accession #: NP_510889
• Nucleotide Accession #: NC_003287
• Protein Size (# AA): Recombinant
• Molecular Weight: 19.7 kDa