ITPK1 Antibody - middle region (ARP54994_P050)

Catalog No: ARP54994_P050

WB Suggested Anti-ITPK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ITPK1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ITPK1 (ARP54994_P050) antibody is Catalog # AAP54994 (Previous Catalog # AAPP32255)

Target Info

• Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374
• Gene Symbol: ITPK1
• Gene Full Name: Inositol-tetrakisphosphate 1-kinase
• Alias Symbols: ITRPK1
• NCBI Gene Id: 3705
• Protein Name: Inositol-tetrakisphosphate 1-kinase
• Description of Target: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of A
• Uniprot ID: Q13572
• Protein Accession #: NP_055031
• Nucleotide Accession #: NM_013417
• Protein Size (# AA): 414
• Molecular Weight: 45kDa
• Protein Interactions: UBC; TP53; NFKBIA; JUN; ITPK1; GPS1; COPS8; TRAF2;