ITIH4 Recombinant Protein (Human) (OPCA02999)

Catalog No: OPCA02999

Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.

ITIH4 Recombinant Protein (Human) (OPCA02999) in SDS-PAGE showing the molecular weight of approximately 28.9 kDa.

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Host: Human
• Reconstitution and Storage: -20°C or -80°C
• Purification: Affinity purified using IMAC.
• Concentration: Varies by lot. See vial for concentration.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Peptide Sequence: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
• Protein Sequence: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
• Source: Yeast
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: BIP co-chaperone MTJ1/ERDJ1 interacts with inter-alpha-trypsin inhibitor heavy chain 4. Kroczynska B., King-Simmons L., Alloza L., Alava M.A., Elguindi E.C., Blond S.Y. Biochem. Biophys. Res. Commun. 338:1467-1477(2005)
• Gene Symbol: ITIH4
• Gene Full Name: inter-alpha-trypsin inhibitor heavy chain 4
• Alias Symbols: GP120;H4P;IHRP;inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein);inter-alpha-inhibitor heavy chain 4;inter-alpha-trypsin inhibitor family heavy chain-related protein;inter-alpha-trypsin inhibitor heavy chain family member 4;inter-alpha-trypsin inhibitor heavy chain H4;inter-alpha-trypsin inhibitor, heavy chain-like, 1;ITI heavy chain H4;ITI-HC4;ITIHL1;PK120;PK-120;Plasma kallikrein sensitive glycoprotein 120;plasma kallikrein-sensitive glycoprotein 120.
• NCBI Gene Id: 3700
• Protein Name: Inter-alpha-trypsin inhibitor heavy chain H4
• Description of Target: Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
• Uniprot ID: Q14624
• Protein Accession #: NP_001159921.1
  
• Nucleotide Accession #: NM_001166449.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 28.9 kDa