Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP84428_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

ITGA6 Antibody - N-terminal region (ARP84428_P050)

Catalog#: ARP84428_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ITGA6
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: QGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGD
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ITGA6 (ARP84428_P050) antibody is Catalog # AAP84428
Datasheets/ManualsPrintable datasheet for anti-ITGA6 (ARP84428_P050) antibody
Gene SymbolITGA6
Official Gene Full Nameintegrin subunit alpha 6
Alias SymbolsCD49f, VLA-6, ITGA6B
NCBI Gene Id3655
Protein Nameintegrin alpha-6
Description of TargetThe gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants.
Swissprot IdP23229-7
Protein Accession #NP_000201.2
Nucleotide Accession #NM_000210.3
Protein Size (# AA)954
Molecular Weight104 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ITGA6.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ITGA6.
Write Your Own Review
You're reviewing:ITGA6 Antibody - N-terminal region (ARP84428_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Tissue Tool
Aviva Live Chat
Aviva Tips and Tricks