Search Antibody, Protein, and ELISA Kit Solutions

ITGA6 Antibody - N-terminal region (ARP84428_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
ITGA6
Official Gene Full Name:
integrin subunit alpha 6
NCBI Gene Id:
3655
Protein Name:
integrin alpha-6
Swissprot Id:
P23229-7
Protein Accession #:
NP_000201.2
Nucleotide Accession #:
NM_000210.3
Alias Symbols:
CD49f, VLA-6, ITGA6B
Description of Target:
The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
954
Molecular Weight:
104 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ITGA6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ITGA6.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ITGA6
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: QGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ITGA6 (ARP84428_P050) antibody is Catalog # AAP84428
Datasheets/Manuals:
Printable datasheet for anti-ITGA6 (ARP84428_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...