ITGA6 Antibody - N-terminal region (ARP80509_P050)

Catalog No: ARP80509_P050

Host: Rabbit
Target Name: ITGA6
Sample Tissue: Human Lung Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ITGA6
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ITGA6 (ARP80509_P050) antibody is Catalog # AAP80509

Target Info

• Gene Symbol: ITGA6
• Gene Full Name: integrin subunit alpha 6
• Alias Symbols: CD49f, VLA-6, ITGA6B
• NCBI Gene Id: 3655
• Protein Name: integrin alpha-6
• Description of Target: The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants.
• Uniprot ID: P23229-7
• Protein Accession #: NP_000201.2
• Nucleotide Accession #: NM_000210.3
• Protein Size (# AA): 954
• Molecular Weight: 104 kDa