Catalog No: ARP53716_P050
Price: $0.00
SKU
ARP53716_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ISYNA1 Antibody - N-terminal region (ARP53716_P050)

Datasheets/ManualsPrintable datasheet for anti-ISYNA1 (ARP53716_P050) antibody
Product Info
ReferenceSeelan,R.S., (2004) Arch. Biochem. Biophys. 431 (1), 95-106
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ISYNA1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 86%; Yeast: 92%
Peptide SequenceSynthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD
Concentration0.5 mg/ml
Blocking PeptideFor anti-ISYNA1 (ARP53716_P050) antibody is Catalog # AAP53716 (Previous Catalog # AAPP30556)
Sample Type Confirmation

ISYNA1 is supported by BioGPS gene expression data to be expressed in HepG2

Enhanced Validation
WBY
SPR
YCHAROS
Gene SymbolISYNA1
Gene Full NameInositol-3-phosphate synthase 1
Alias SymbolsIPS, INO1, INOS, IPS 1, IPS-1
NCBI Gene Id51477
Protein NameInositol-3-phosphate synthase 1
Description of TargetMyoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate.Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate (Seelan et al., 2004 [PubMed 15464731]).[supplied by OMIM].
Uniprot IDQ9NPH2
Protein Accession #NP_057452
Nucleotide Accession #NM_016368
Protein Size (# AA)558
Molecular Weight61kDa
Protein InteractionsTRAF4; UBC; DUSP14; POT1; PPP2CA;
  1. What is the species homology for "ISYNA1 Antibody - N-terminal region (ARP53716_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Yeast".

  2. How long will it take to receive "ISYNA1 Antibody - N-terminal region (ARP53716_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ISYNA1 Antibody - N-terminal region (ARP53716_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ISYNA1 Antibody - N-terminal region (ARP53716_P050)"?

    This target may also be called "IPS, INO1, INOS, IPS 1, IPS-1" in publications.

  5. What is the shipping cost for "ISYNA1 Antibody - N-terminal region (ARP53716_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ISYNA1 Antibody - N-terminal region (ARP53716_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ISYNA1 Antibody - N-terminal region (ARP53716_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ISYNA1 Antibody - N-terminal region (ARP53716_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ISYNA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ISYNA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ISYNA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ISYNA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ISYNA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ISYNA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ISYNA1 Antibody - N-terminal region (ARP53716_P050)
Your Rating
We found other products you might like!