ISL1 Antibody - C-terminal region (ARP89151_P050)

Catalog No: ARP89151_P050

Host: Rabbit
Target Name: ISL1
Sample Tissue: Mouse Kidney lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse ISL1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ISL1 (ARP89151_P050) antibody is Catalog # AAP89151

Target Info

• Gene Symbol: ISL1
• Gene Full Name: ISL1 transcription factor, LIM/homeodomain
• NCBI Gene Id: 16392
• Protein Name: insulin gene enhancer protein ISL-1
• Description of Target: DNA-binding transcriptional activator. Recognizes and binds to the consensus octamer binding site 5'-ATAATTAA-3' in promoter of target genes. Plays a fundamental role in the gene regulatory network essential for retinal ganglion cell (RGC) differentiation. Cooperates with the transcription factor POU4F2 to achieve maximal levels of expression of RGC target genes and RGC fate specification in the developing retina. Involved in the specification of motor neurons in cooperation with LHX3 and LDB1. Binds to insulin gene enhancer sequences (By similarity). Essential for heart development. Marker of one progenitor cell population that give rise to the outflow tract, right ventricle, a subset of left ventricular cells, and a large number of atrial cells as well, its function is required for these progenitors to contribute to the heart. Controls the expression of FGF and BMP growth factors in this cell population and is required for proliferation and survival of cells within pharyngeal foregut endoderm and adjacent splanchnic mesoderm as well as for migration of cardiac progenitors into the heart.
• Uniprot ID: P61372
• Protein Accession #: NP_067434.3
• Nucleotide Accession #: NM_021459.4
• Protein Size (# AA): 349
• Molecular Weight: 38 kDa