Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ISGF3G antibody - N-terminal region (ARP31200_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP31200_P050-FITC Conjugated

ARP31200_P050-HRP Conjugated

ARP31200_P050-Biotin Conjugated

Gene Symbol:
IRF9
NCBI Gene Id:
10379
Official Gene Full Name:
Interferon regulatory factor 9
Protein Name:
Interferon regulatory factor 9
Swissprot Id:
Q00978
Protein Accession #:
NP_006075
Nucleotide Accession #:
NM_006084
Alias Symbols:
IRF-9, ISGF3, ISGF3G, p48
Replacement Item:
This antibody may replace item sc-10793 from Santa Cruz Biotechnology.
Description of Target:
ISGF3G functions to recruit RNA polymerase II to the promoter of interferon-stimulated genes and requires histone deacetylases. Defects in ISGF3 can cause resistance to IFN-.(2a) treatment.
Protein Size (# AA):
393
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ISGF3G.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ISGF3G.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ISGF3G
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-ISGF3G (ARP31200_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
S100A13; MYO1F; TOP1; IRF1; IRF2BP1; DNMT3A; ELAVL1; STAT2; IFNAR2; CREBBP; DACH2; DMRTC2; TLX3; VENTX; ARID3B; NR2E3; POU2F1; HOXC9; TLX2; STAT1; IFNA1; RELA; NFKB1;
Blocking Peptide:
For anti-IRF9 (ARP31200_P050) antibody is Catalog # AAP31200 (Previous Catalog # AAPS26406)
Datasheets/Manuals:
Printable datasheet for anti-IRF9 (ARP31200_P050) antibody
Target Reference:
Lau,J.F., et al., (2003) Mol. Cell. Biol. 23 (2), 620-628
Publications:

Bidwell, B. N. et al. Silencing of Irf7 pathways in breast cancer cells promotes bone metastasis through immune escape. Nat. Med. 18, 1224-31 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22820642

Tell us what you think about this item!

Write A Review
    Please, wait...