Search Antibody, Protein, and ELISA Kit Solutions

ISGF3G Antibody - N-terminal region (ARP31200_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31200_P050-FITC Conjugated

ARP31200_P050-HRP Conjugated

ARP31200_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Interferon regulatory factor 9
NCBI Gene Id:
Protein Name:
Interferon regulatory factor 9
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
IRF-9, ISGF3, ISGF3G, p48
Replacement Item:
This antibody may replace item sc-10793 from Santa Cruz Biotechnology.
Description of Target:
ISGF3G functions to recruit RNA polymerase II to the promoter of interferon-stimulated genes and requires histone deacetylases. Defects in ISGF3 can cause resistance to IFN-.(2a) treatment.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ISGF3G.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ISGF3G.
The immunogen is a synthetic peptide directed towards the N terminal region of human ISGF3G
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-ISGF3G (ARP31200_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-IRF9 (ARP31200_P050) antibody is Catalog # AAP31200 (Previous Catalog # AAPS26406)
Printable datasheet for anti-IRF9 (ARP31200_P050) antibody
Target Reference:
Lau,J.F., et al., (2003) Mol. Cell. Biol. 23 (2), 620-628

Bidwell, B. N. et al. Silencing of Irf7 pathways in breast cancer cells promotes bone metastasis through immune escape. Nat. Med. 18, 1224-31 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22820642

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...