Protein on Demand™ IRX2 Recombinant Protein (Human) (OPCA324663)

Datasheets/Manuals	Printable datasheet for OPCA324663

Product Info
Predicted Species Reactivity	Human
Product Format	Liquid
Application	WB, ELISA
Additional Information	For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request.
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAATGFGSPLQYSADAAAAAAGFPSYMGAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDEDEGDATRSKDESPDKAQEGTETSAEDEGISLHVDSLTDHSCSAESDGEKLPCRAGDPLCESGSECKDKYDDLEDDEDDDEEGERGLAPPKPVTSSPLTGLEAPLLSPPPEAAPRGGRKTPQGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCGPPGLPAAAAPASTGAPPGGSPYPASPLLGRPLYYTSPFYGNYTNYGNLNAALQGQGLLRYNSAAAAPGEALHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-471

Gene Full Name	iroquois homeobox 2
Alias Symbols	IRXA2
NCBI Gene Id	153572
Protein Name	iroquois-class homeodomain protein IRX-2
Description of Target	IRX2 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos.[supplied by OMIM, Apr 2004]
Uniprot ID	Q9BZI1
Protein Accession #	NP_001127694.1
Nucleotide Accession #	NM_001134222.1
Protein Size (# AA)	471