Search Antibody, Protein, and ELISA Kit Solutions

IRF8 Antibody - N-terminal region (P100841_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100841_P050-FITC Conjugated

P100841_P050-HRP Conjugated

P100841_P050-Biotin Conjugated

Gene Symbol:
IRF8
Official Gene Full Name:
Interferon regulatory factor 8
NCBI Gene Id:
3394
Protein Name:
Interferon regulatory factor 8
Swissprot Id:
Q02556
Protein Accession #:
NP_002154
Nucleotide Accession #:
NM_002163
Alias Symbols:
ICSBP, IRF-8, ICSBP1, H-ICSBP
Replacement Item:
This antibody may replace item sc-32527 from Santa Cruz Biotechnology.
Description of Target:
Interferon regulatory factor 8 (IRF8, interferon consensus sequence-binding protein, Ion ChannelSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-. and IFN-.. IRF family proteins also control expression of IFN-. and IFN-.-regulated genes that are induced by viral infection.
Protein Size (# AA):
426
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IRF8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IRF8.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human IRF8
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-IRF8 (P100841_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SPI1; IRF1; TOP1; ZBTB17; PDGFRB; CBL; UBC; COPS4; COPS5; COPS6; COPS2; MID1; IRF6; GPS1; CDK4; SQSTM1; TRAF6; SMURF2; IRF2; TRIM21; IRF8; ETV6; RELA; NFKB1;
Blocking Peptide:
For anti-IRF8 (P100841_P050) antibody is Catalog # AAP31198 (Previous Catalog # AAPP01941)
Datasheets/Manuals:
Printable datasheet for anti-IRF8 (P100841_P050) antibody
Target Reference:
Weisz,A., et al., (1992) J. Biol. Chem. 267 (35), 25589-25596

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...