IRF8 Antibody - N-terminal region : Biotin (P100841_T100-Biotin)

Catalog No: P100841_T100-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IRF8
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IRF8 (P100841_T100-Biotin) antibody is Catalog # AAP31198

Target Info

• Reference: Nehyba,J., et al., (2002) Mol. Cell. Biol. 22 (11), 3942-3957
• Gene Symbol: IRF8
• Gene Full Name: Interferon regulatory factor 8
• Alias Symbols: ICSBP, IRF-8, ICSBP1, IMD32A, IMD32B, H-ICSBP
• NCBI Gene Id: 3394
• Protein Name: Interferon regulatory factor 8
• Description of Target: Interferon consensus sequence-binding protein (Ion ChannelSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection.
• Uniprot ID: Q02556
• Protein Accession #: NP_002154
• Nucleotide Accession #: NM_002163
• Protein Size (# AA): 426
• Molecular Weight: 48kDa
• Protein Interactions: SPI1; IRF1; TOP1; ZBTB17; PDGFRB; CBL; UBC; COPS4; COPS5; COPS6; COPS2; MID1; IRF6; GPS1; CDK4; SQSTM1; TRAF6; SMURF2; IRF2; TRIM21; IRF8; ETV6; RELA; NFKB1;