Search Antibody, Protein, and ELISA Kit Solutions

IRF8 Antibody - C-terminal region (ARP31199_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31199_P050-FITC Conjugated

ARP31199_P050-HRP Conjugated

ARP31199_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
IRF8
Official Gene Full Name:
Interferon regulatory factor 8
NCBI Gene Id:
3394
Protein Name:
Interferon regulatory factor 8
Swissprot Id:
Q02556
Protein Accession #:
NP_002154
Nucleotide Accession #:
NM_002163
Alias Symbols:
H-ICSBP, ICSBP, ICSBP1, IRF-8
Replacement Item:
This antibody may replace item sc-32527 from Santa Cruz Biotechnology.
Description of Target:
Interferon regulatory factor 8 (IRF8, interferon consensus sequence-binding protein, ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-. and IFN-.. IRF family proteins also control expression of IFN-. and IFN-.-regulated genes that are induced by viral infection.
Protein Size (# AA):
426
Molecular Weight:
48kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IRF8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IRF8.
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-IRF8 (ARP31199_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQIT
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SPI1; IRF1; TOP1; ZBTB17; PDGFRB; CBL; UBC; COPS4; COPS5; COPS6; COPS2; MID1; IRF6; GPS1; CDK4; SQSTM1; TRAF6; SMURF2; IRF2; TRIM21; IRF8; ETV6; RELA; NFKB1;
Blocking Peptide:
For anti-IRF8 (ARP31199_P050) antibody is Catalog # AAP31199
Datasheets/Manuals:
Printable datasheet for anti-IRF8 (ARP31199_P050) antibody
Publications:

Ye, L. et al. CD56+ T cells inhibit hepatitis C virus replication in human hepatocytes. Hepatology 49, 753-62 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 19085952

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...