Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP31199_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31199_P050-FITC Conjugated

ARP31199_P050-HRP Conjugated

ARP31199_P050-Biotin Conjugated

IRF8 Antibody - C-terminal region (ARP31199_P050)

Catalog#: ARP31199_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-32527 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology data Anti-IRF8 (ARP31199_P050)
Peptide Sequence Synthetic peptide located within the following region: QLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQIT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IRF8 (ARP31199_P050) antibody is Catalog # AAP31199
Datasheets/Manuals Printable datasheet for anti-IRF8 (ARP31199_P050) antibody
Publications

Ye, L. et al. CD56+ T cells inhibit hepatitis C virus replication in human hepatocytes. Hepatology 49, 753-62 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 19085952

Gene Symbol IRF8
Official Gene Full Name Interferon regulatory factor 8
Alias Symbols H-ICSBP, ICSBP, ICSBP1, IRF-8
NCBI Gene Id 3394
Protein Name Interferon regulatory factor 8
Description of Target Interferon regulatory factor 8 (IRF8, interferon consensus sequence-binding protein, ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-. and IFN-.. IRF family proteins also control expression of IFN-. and IFN-.-regulated genes that are induced by viral infection.
Swissprot Id Q02556
Protein Accession # NP_002154
Nucleotide Accession # NM_002163
Protein Size (# AA) 426
Molecular Weight 48kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IRF8.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IRF8.
Protein Interactions SPI1; IRF1; TOP1; ZBTB17; PDGFRB; CBL; UBC; COPS4; COPS5; COPS6; COPS2; MID1; IRF6; GPS1; CDK4; SQSTM1; TRAF6; SMURF2; IRF2; TRIM21; IRF8; ETV6; RELA; NFKB1;
Write Your Own Review
You're reviewing:IRF8 Antibody - C-terminal region (ARP31199_P050)
Your Rating