Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP31995_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31995_P050-FITC Conjugated

ARP31995_P050-HRP Conjugated

ARP31995_P050-Biotin Conjugated

IRF6 Antibody - middle region (ARP31995_P050)

Catalog#: ARP31995_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130790 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IRF6
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85%
Complete computational species homology data Anti-IRF6 (ARP31995_P050)
Peptide Sequence Synthetic peptide located within the following region: IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IRF6 (ARP31995_P050) antibody is Catalog # AAP31995 (Previous Catalog # AAPP02892)
Datasheets/Manuals Printable datasheet for anti-IRF6 (ARP31995_P050) antibody
Target Reference Vieira,A.R., (er) Arch. Oral Biol. (2008) In press
Publications

Iwata, J. et al. Smad4-Irf6 genetic interaction and TGFb-mediated IRF6 signaling cascade are crucial for palatal fusion in mice. Development 140, 1220-30 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 23406900

Gene Symbol IRF6
Official Gene Full Name Interferon regulatory factor 6
Alias Symbols LPS, OFC6, PIT, PPS, VWS, VWS1
NCBI Gene Id 3664
Protein Name Interferon regulatory factor 6
Description of Target IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction. This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O14896
Protein Accession # NP_006138
Nucleotide Accession # NM_006147
Protein Size (# AA) 467
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IRF6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IRF6.
Protein Interactions HHV8GK18_gp81; UBC; BNC2; IRF5; IRF8; ZBTB3; RFX3; TLX2; LBP;
Write Your Own Review
You're reviewing:IRF6 Antibody - middle region (ARP31995_P050)
Your Rating