Search Antibody, Protein, and ELISA Kit Solutions

IRF6 Antibody - middle region (ARP31995_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31995_P050-FITC Conjugated

ARP31995_P050-HRP Conjugated

ARP31995_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Interferon regulatory factor 6
NCBI Gene Id:
Protein Name:
Interferon regulatory factor 6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-130790 from Santa Cruz Biotechnology.
Description of Target:
IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction. This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IRF6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IRF6.
The immunogen is a synthetic peptide directed towards the middle region of human IRF6
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-IRF6 (ARP31995_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HHV8GK18_gp81; UBC; BNC2; IRF5; IRF8; ZBTB3; RFX3; TLX2; LBP;
Blocking Peptide:
For anti-IRF6 (ARP31995_P050) antibody is Catalog # AAP31995 (Previous Catalog # AAPP02892)
Printable datasheet for anti-IRF6 (ARP31995_P050) antibody
Target Reference:
Vieira,A.R., (er) Arch. Oral Biol. (2008) In press

Iwata, J. et al. Smad4-Irf6 genetic interaction and TGFb-mediated IRF6 signaling cascade are crucial for palatal fusion in mice. Development 140, 1220-30 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 23406900

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...