Search Antibody, Protein, and ELISA Kit Solutions

IRF3 Antibody - C-terminal region (ARP31992_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31992_P050-FITC Conjugated

ARP31992_P050-HRP Conjugated

ARP31992_P050-Biotin Conjugated

Gene Symbol:
IRF3
Official Gene Full Name:
Interferon regulatory factor 3
NCBI Gene Id:
3661
Protein Name:
Interferon regulatory factor 3
Swissprot Id:
Q14653
Protein Accession #:
NP_001562
Nucleotide Accession #:
NM_001571
Replacement Item:
This antibody may replace item sc-15991 from Santa Cruz Biotechnology.
Description of Target:
IRF3 is interferon regulatory factor 3, a member of the interferon regulatory transcription factor (IRF) family. IRF3 is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes.IRF3 encodes interferon regulatory factor 3, a member of the interferon regulatory transcription factor (IRF) family. IRF3 is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes.IRF3 encodes interferon regulatory factor 3, a member of the interferon regulatory transcription factor (IRF) family. IRF3 is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes.
Protein Size (# AA):
427
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IRF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IRF3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human IRF3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-IRF3 (ARP31992_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
IRF3; UBC; TMEM173; POLR2A; DEAF1; CREBBP; MAFB; vIRF-3; SMAD4; SMAD2; FOXO1; vIRF-1; EP300; SGTA; PEX19; HSP90AA1; PIAS4; TBK1; TOMM70A; TLR2; MAPK9; MAPK8; MAVS; DDX58; TRAF3; ISG15; TRIM21; PIN1; IRF7; HERC5; IKBKE; CUL1; SUMO2; XIAP; HDAC3; SOCS1; RBL
Blocking Peptide:
For anti-IRF3 (ARP31992_P050) antibody is Catalog # AAP31992 (Previous Catalog # AAPP23941)
Datasheets/Manuals:
Printable datasheet for anti-IRF3 (ARP31992_P050) antibody
Target Reference:
Korherr,C., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (11), 4240-4245

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...