IPO5 Antibody - N-terminal region (ARP97500_P050)

Catalog No: ARP97500_P050

Host: Rabbit
Target Name: RANBP5
Sample Tissue: Human THP-1 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RANBP5
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: SDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IPO5 (ARP97500_P050) antibody is Catalog # AAP97500

Target Info

• Gene Symbol: IPO5
• Gene Full Name: importin 5
• Alias Symbols: IMB3, Pse1, imp5, KPNB3, RANBP5
• NCBI Gene Id: 3843
• Protein Name: importin-5
• Description of Target: Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family.
• Uniprot ID: O00410
• Protein Accession #: NP_002262.3
• Nucleotide Accession #: NM_002271.4
• Protein Size (# AA): 1097
• Molecular Weight: 120 kDa