INSR Antibody - middle region (AVARP08005_P050)

Catalog No: AVARP08005_P050

WB Suggested Anti-INSR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate

Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Placenta
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human INSR
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: SSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-INSR (AVARP08005_P050) antibody is Catalog # AAP30446 (Previous Catalog # AAPP01030)

Target Info

• Reference: Netzer,C., (2008) Genomics 91 (6), 503-507
• Gene Symbol: INSR
• Gene Full Name: Insulin receptor
• Alias Symbols: HHF5, CD220
• NCBI Gene Id: 3643
• Protein Name: Insulin receptor
• Description of Target: This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin. INSR binding to insulin stimulates association of the receptor with downstream mediators including IRS1 and phosphatidylinositol 3'-kinase (PI3K). INSR can activate PI3K either directly by binding to the p85 regulatory subunit, or indirectly via IRS1. When present in a hybrid receptor with IGF1R, it binds IGF1.A report shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, another report shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.After removal of the precursor signal peptide, the insulin receptor precursor is post-translationally cleaved into two chains (alpha and beta) that are covalently linked. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: P06213
• Protein Accession #: NP_000199
• Nucleotide Accession #: NM_000208
• Protein Size (# AA): 1382
• Molecular Weight: 154kDa
• Protein Interactions: KRT31; UBC; ARRB2; MOK; Grb2; Hgf; DOK1; SH2B1; Stat5b; TEAD1; STAT5A; JAK2; JAK1; IRS1; IRF7; PLCG1; GRB10; Socs6; Socs1; SOCS3; SH2B2; HGS; INPPL1; Calmodulin; Mad2l1; KRT27; DOK5; DOK4; SNX6; SNX4; SNX2; ACP1; PTPN2; SYNCRIP; FRS2; PIK3R3; VAV3; ARHGAP