Catalog No: ARP41374_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-INSR (ARP41374_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human INSR
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR
Concentration0.5 mg/ml
Blocking PeptideFor anti-INSR (ARP41374_P050) antibody is Catalog # AAP41374 (Previous Catalog # AAPP24112)
ReferenceNetzer,C., (2008) Genomics 91 (6), 503-507
Gene SymbolINSR
Gene Full NameInsulin receptor
Alias SymbolsHHF5, CD220
NCBI Gene Id3643
Protein NameInsulin receptor
Description of TargetThis receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin. INSR binding to insulin stimulates association of the receptor with downstream media
Uniprot IDP06213
Protein Accession #NP_000199
Nucleotide Accession #NM_000208
Protein Size (# AA)1382
Molecular Weight154kDa
Protein InteractionsKRT31; UBC; ARRB2; MOK; Grb2; Hgf; DOK1; SH2B1; Stat5b; TEAD1; STAT5A; JAK2; JAK1; IRS1; IRF7; PLCG1; GRB10; Socs6; Socs1; SOCS3; SH2B2; HGS; INPPL1; Calmodulin; Mad2l1; KRT27; DOK5; DOK4; SNX6; SNX4; SNX2; ACP1; PTPN2; SYNCRIP; FRS2; PIK3R3; VAV3; ARHGAP
  1. What is the species homology for "INSR Antibody - middle region (ARP41374_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "INSR Antibody - middle region (ARP41374_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "INSR Antibody - middle region (ARP41374_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "INSR Antibody - middle region (ARP41374_P050)"?

    This target may also be called "HHF5, CD220" in publications.

  5. What is the shipping cost for "INSR Antibody - middle region (ARP41374_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "INSR Antibody - middle region (ARP41374_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "INSR Antibody - middle region (ARP41374_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "154kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "INSR Antibody - middle region (ARP41374_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "INSR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "INSR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "INSR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "INSR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "INSR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "INSR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:INSR Antibody - middle region (ARP41374_P050)
Your Rating