Catalog No: ARP41373_P050
Price: $0.00
SKU
ARP41373_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Insr (ARP41373_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: EEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPY
Concentration0.5 mg/ml
Blocking PeptideFor anti-Insr (ARP41373_P050) antibody is Catalog # AAP41373 (Previous Catalog # AAPP24111)
Gene SymbolInsr
Gene Full NameInsulin receptor
Alias SymbolsI, IR, IR-A, IR-B, CD220, 4932439J01Rik, D630014A15Rik
NCBI Gene Id16337
Protein NameInsulin receptor
Description of TargetThis receptor binds insulin and has a tyrosine-protein kinase activity. When it is present in a hybrid receptor with IGF1R, binds IGF1.
Uniprot IDP15208
Protein Accession #NP_034698
Nucleotide Accession #NM_010568
Protein Size (# AA)1372
Molecular Weight155kDa
Protein InteractionsArrb2; Src; Akt1; Jup; Irs1; Grb10; Snx9; Dok3; Sh2b2; Flot1; Dok1; Cav3; Socs1; Socs3; Sorbs1; Cav1; Pik3r1;
  1. What is the species homology for "Insr Antibody - middle region (ARP41373_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "Insr Antibody - middle region (ARP41373_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Insr Antibody - middle region (ARP41373_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Insr Antibody - middle region (ARP41373_P050)"?

    This target may also be called "I, IR, IR-A, IR-B, CD220, 4932439J01Rik, D630014A15Rik" in publications.

  5. What is the shipping cost for "Insr Antibody - middle region (ARP41373_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Insr Antibody - middle region (ARP41373_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Insr Antibody - middle region (ARP41373_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "155kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Insr Antibody - middle region (ARP41373_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "INSR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "INSR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "INSR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "INSR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "INSR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "INSR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Insr Antibody - middle region (ARP41373_P050)
Your Rating
We found other products you might like!