INSM1 Antibody - middle region (ARP90761_P050)

Catalog No: ARP90761_P050

Host: Rabbit
Target Name: INSM1
Sample Tissue: Mouse Testis lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse INSM1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EAAGGGSSDRDTPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-INSM1 (ARP90761_P050) antibody is Catalog # AAP90761

Target Info

• Gene Symbol: INSM1
• Gene Full Name: insulinoma-associated 1
• Alias Symbols: IA, IA-1
• NCBI Gene Id: 53626
• Protein Name: insulinoma-associated protein 1
• Description of Target: Sequence-specific DNA-binding transcriptional regulator that plays a key role in neurogenesis and neuroendocrine cell differentiation during embryonic and/or fetal development. Binds to the consensus sequence 5'-[TG][TC][TC][TT][GA]GGG[CG]A-3' in target promoters. Acts as a transcriptional repressor of NEUROD1 and INS expression via its interaction with cyclin CCND1 in a cell cycle-independent manner. Negatively regulates skeletal muscle-specific gene expression in endocrine cells of the pituitary by inhibiting the Notch signaling pathway. Represses target gene transcription by recruiting chromatin-modifying factors, such as HDAC1, HDAC2, HDAC3, KDM1A and RCOR1 histone deacetylases. Binds to its own promoter, suggesting autoregulation as a self-control feedback mechanism. Promotes the generation and expansion of neuronal basal progenitor cells in the developing neocortex. Involved in the differentiation of endocrine cells of the developing anterior pituitary gland, of the pancreas and intestine, and of sympatho-adrenal cells in the peripheral nervous system. Promotes cell cycle signaling arrest and inhibition of cellular proliferation.
• Uniprot ID: Q63ZV0
• Protein Accession #: NP_058585.2
• Nucleotide Accession #: NM_016889.3
• Protein Size (# AA): 521
• Molecular Weight: 54 kDa