Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP40165_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40165_P050-FITC Conjugated

ARP40165_P050-HRP Conjugated

ARP40165_P050-Biotin Conjugated

INSIG2 Antibody - N-terminal region (ARP40165_P050)

Catalog#: ARP40165_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-34821 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human INSIG2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%
Complete computational species homology data Anti-INSIG2 (ARP40165_P050)
Peptide Sequence Synthetic peptide located within the following region: MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-INSIG2 (ARP40165_P050) antibody is Catalog # AAP40165 (Previous Catalog # AAPY00799)
Datasheets/Manuals Printable datasheet for anti-INSIG2 (ARP40165_P050) antibody
Target Reference Li,C.G., (2008) Int. J. Cancer 123 (2), 273-282
Publications

Yu, Z. et al. Rapamycin and Dietary Restriction Induce Metabolically Distinctive Changes in Mouse Liver. J. Gerontol. A. Biol. Sci. Med. Sci. 70, 410-20 (2015). WB, Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 24755936

Gene Symbol INSIG2
Official Gene Full Name Insulin induced gene 2
Alias Symbols MGC26273
NCBI Gene Id 51141
Protein Name Insulin-induced gene 2 protein
Description of Target INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q9Y5U4
Protein Accession # NP_057217
Nucleotide Accession # NM_016133
Protein Size (# AA) 225
Molecular Weight 25kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express INSIG2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express INSIG2.
Protein Interactions RNF5; HMGCR; SCAP; SREBF1; RNF139; UBQLN1; UBQLN2; FAF2; ADRM1; PSMD14; BAG6; VCP; UBC; RPN1; PSMD13; PSMD12; PSMD11; PSMD4; PSMC6; PSMC5; PSMC3; PSMC2; PSMB3; PSMB1; PSMA7; PSMA2; LGALS7; JUP; INSIG1; HSPA8; HSPA6; HSPA5; HSPA1A; ENO1; DSP; AMFR; SREBF2;
Write Your Own Review
You're reviewing:INSIG2 Antibody - N-terminal region (ARP40165_P050)
Your Rating