Search Antibody, Protein, and ELISA Kit Solutions

INSIG2 antibody - N-terminal region (ARP40165_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40165_P050-FITC Conjugated

ARP40165_P050-HRP Conjugated

ARP40165_P050-Biotin Conjugated

Gene Symbol:
INSIG2
NCBI Gene Id:
51141
Official Gene Full Name:
Insulin induced gene 2
Protein Name:
Insulin-induced gene 2 protein
Swissprot Id:
Q9Y5U4
Protein Accession #:
NP_057217
Nucleotide Accession #:
NM_016133
Alias Symbols:
MGC26273
Replacement Item:
This antibody may replace item sc-34821 from Santa Cruz Biotechnology.
Description of Target:
INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
225
Molecular Weight:
25kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express INSIG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express INSIG2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human INSIG2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%
Complete computational species homology data:
Anti-INSIG2 (ARP40165_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RNF5; HMGCR; SCAP; SREBF1; RNF139; UBQLN1; UBQLN2; FAF2; ADRM1; PSMD14; BAG6; VCP; UBC; RPN1; PSMD13; PSMD12; PSMD11; PSMD4; PSMC6; PSMC5; PSMC3; PSMC2; PSMB3; PSMB1; PSMA7; PSMA2; LGALS7; JUP; INSIG1; HSPA8; HSPA6; HSPA5; HSPA1A; ENO1; DSP; AMFR; SREBF2;
Blocking Peptide:
For anti-INSIG2 (ARP40165_P050) antibody is Catalog # AAP40165 (Previous Catalog # AAPY00799)
Datasheets/Manuals:
Printable datasheet for anti-INSIG2 (ARP40165_P050) antibody
Target Reference:
Li,C.G., (2008) Int. J. Cancer 123 (2), 273-282
Publications:

Yu, Z. et al. Rapamycin and Dietary Restriction Induce Metabolically Distinctive Changes in Mouse Liver. J. Gerontol. A. Biol. Sci. Med. Sci. glu053- (2014). doi:10.1093/gerona/glu053 WB, Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 24755936

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...