Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP61153_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP61153_P050-FITC Conjugated

ARP61153_P050-HRP Conjugated

ARP61153_P050-Biotin Conjugated

INPP5K Antibody - N-terminal region (ARP61153_P050)

Catalog#: ARP61153_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-158962 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 92%; Zebrafish: 90%
Complete computational species homology dataAnti-INPP5K (ARP61153_P050)
Peptide SequenceSynthetic peptide located within the following region: LVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYGYYVSIINC
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-INPP5K (ARP61153_P050) antibody is Catalog # AAP61153
Datasheets/ManualsPrintable datasheet for anti-INPP5K (ARP61153_P050) antibody
Gene SymbolINPP5K
Official Gene Full NameInositol polyphosphate-5-phosphatase K
Alias SymbolsPPS, SKIP
NCBI Gene Id51763
Protein NameInositol polyphosphate 5-phosphatase K
Description of TargetThis gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified.
Swissprot IdQ9BT40-2
Protein Accession #NP_570122
Nucleotide Accession #NM_130766
Protein Size (# AA)372
Molecular Weight41kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express INPP5K.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express INPP5K.
Protein InteractionsFATE1; MAD2L1BP; UBC; KRT31; TCP1; EXOC3; CPTP; TANK; BDNF; RIPK3; TTR; TK1; SMN1; PFDN1; HMOX2; CDKN1A; ANXA7; ARL6IP1; NCOR2;
  1. What is the species homology for "INPP5K Antibody - N-terminal region (ARP61153_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "INPP5K Antibody - N-terminal region (ARP61153_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "INPP5K Antibody - N-terminal region (ARP61153_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "INPP5K Antibody - N-terminal region (ARP61153_P050)"?

    This target may also be called "PPS, SKIP" in publications.

  5. What is the shipping cost for "INPP5K Antibody - N-terminal region (ARP61153_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "INPP5K Antibody - N-terminal region (ARP61153_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "INPP5K Antibody - N-terminal region (ARP61153_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "INPP5K Antibody - N-terminal region (ARP61153_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "INPP5K"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "INPP5K"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "INPP5K"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "INPP5K"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "INPP5K"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "INPP5K"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:INPP5K Antibody - N-terminal region (ARP61153_P050)
Your Rating
Aviva Pathways
Aviva HIS tag Deal
Aviva ChIP Antibodies
Aviva Blast Tool