Search Antibody, Protein, and ELISA Kit Solutions

INHBA Antibody - N-terminal region : Biotin (ARP54663_P050-Biotin)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54663_P050 Unconjugated

ARP54663_P050-FITC Conjugated

ARP54663_P050-HRP Conjugated

Predicted Species Reactivity:
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
Biotin
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
INHBA
Official Gene Full Name:
Inhibin, beta A
NCBI Gene Id:
3624
Protein Name:
Inhibin beta A chain
Swissprot Id:
P08476
Protein Accession #:
NP_002183
Nucleotide Accession #:
NM_002192
Alias Symbols:
EDF, FRP
Replacement Item:
This antibody may replace item sc-121067 from Santa Cruz Biotechnology.
Description of Target:
The inhibin beta A subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta A subunit forms a homodimer, activin A, and also joins with a beta B subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. Finally, it has been shown that the beta A subunit mRNA is identical to the erythroid differentiation factor subunit mRNA and that only one gene for this mRNA exists in the human genome.
Protein Size (# AA):
426
Molecular Weight:
44kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express INHBA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express INHBA.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human INHBA
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-INHBA (ARP54663_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALL
Concentration:
0.5 mg/ml
Protein Interactions:
ACVRL1; ACVR2B; ACVR2A; ACVR1; FST; IGSF1; CHRDL2; FSTL3; IGFBP7; ACVR1B; INHBC; TGFBR3; INHBB; INHA; INHBA; ENG;
Blocking Peptide:
For anti-INHBA (ARP54663_P050-Biotin) antibody is Catalog # AAP54663 (Previous Catalog # AAPP44525)
Datasheets/Manuals:
Printable datasheet for anti-INHBA (ARP54663_P050-Biotin) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...