Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP54663_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54663_P050-FITC Conjugated

ARP54663_P050-HRP Conjugated

ARP54663_P050-Biotin Conjugated

INHBA Antibody - N-terminal region (ARP54663_P050)

Catalog#: ARP54663_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityCow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-121067 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human INHBA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology dataAnti-INHBA (ARP54663_P050)
Peptide SequenceSynthetic peptide located within the following region: CPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-INHBA (ARP54663_P050) antibody is Catalog # AAP54663 (Previous Catalog # AAPP44525)
Datasheets/ManualsPrintable datasheet for anti-INHBA (ARP54663_P050) antibody
Publications

Ndiaye, K; Castonguay, A; Benoit, G; Silversides, DW; Lussier, JG; Differential regulation of Janus kinase 3 (JAK3) in bovine preovulatory follicles and identification of JAK3 interacting proteins in granulosa cells. 9, 71 (2016). WB, Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 27793176

Gene SymbolINHBA
Official Gene Full NameInhibin, beta A
Alias SymbolsEDF, FRP
NCBI Gene Id3624
Protein NameInhibin beta A chain
Description of TargetThe inhibin beta A subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta A subunit forms a homodimer, activin A, and also joins with a beta B subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. Finally, it has been shown that the beta A subunit mRNA is identical to the erythroid differentiation factor subunit mRNA and that only one gene for this mRNA exists in the human genome.
Swissprot IdP08476
Protein Accession #NP_002183
Nucleotide Accession #NM_002192
Protein Size (# AA)426
Molecular Weight44kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express INHBA.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express INHBA.
Protein InteractionsACVRL1; ACVR2B; ACVR2A; ACVR1; FST; IGSF1; CHRDL2; FSTL3; IGFBP7; ACVR1B; INHBC; TGFBR3; INHBB; INHA; INHBA; ENG;
Write Your Own Review
You're reviewing:INHBA Antibody - N-terminal region (ARP54663_P050)
Your Rating
Aviva Live Chat
Aviva ChIP Antibodies
Aviva Tissue Tool
Free Microscope