Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP54663_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54663_P050-FITC Conjugated

ARP54663_P050-HRP Conjugated

ARP54663_P050-Biotin Conjugated

INHBA Antibody - N-terminal region (ARP54663_P050)

Catalog#: ARP54663_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-121067 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human INHBA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-INHBA (ARP54663_P050)
Peptide Sequence Synthetic peptide located within the following region: CPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-INHBA (ARP54663_P050) antibody is Catalog # AAP54663 (Previous Catalog # AAPP44525)
Datasheets/Manuals Printable datasheet for anti-INHBA (ARP54663_P050) antibody
Publications

Ndiaye, K; Castonguay, A; Benoit, G; Silversides, DW; Lussier, JG; Differential regulation of Janus kinase 3 (JAK3) in bovine preovulatory follicles and identification of JAK3 interacting proteins in granulosa cells. 9, 71 (2016). WB, Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 27793176

Gene Symbol INHBA
Official Gene Full Name Inhibin, beta A
Alias Symbols EDF, FRP
NCBI Gene Id 3624
Protein Name Inhibin beta A chain
Description of Target The inhibin beta A subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta A subunit forms a homodimer, activin A, and also joins with a beta B subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. Finally, it has been shown that the beta A subunit mRNA is identical to the erythroid differentiation factor subunit mRNA and that only one gene for this mRNA exists in the human genome.
Swissprot Id P08476
Protein Accession # NP_002183
Nucleotide Accession # NM_002192
Protein Size (# AA) 426
Molecular Weight 44kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express INHBA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express INHBA.
Protein Interactions ACVRL1; ACVR2B; ACVR2A; ACVR1; FST; IGSF1; CHRDL2; FSTL3; IGFBP7; ACVR1B; INHBC; TGFBR3; INHBB; INHA; INHBA; ENG;
  1. What is the species homology for "INHBA Antibody - N-terminal region (ARP54663_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep".

  2. How long will it take to receive "INHBA Antibody - N-terminal region (ARP54663_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "INHBA Antibody - N-terminal region (ARP54663_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "INHBA Antibody - N-terminal region (ARP54663_P050)"?

    This target may also be called "EDF, FRP" in publications.

  5. What is the shipping cost for "INHBA Antibody - N-terminal region (ARP54663_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "INHBA Antibody - N-terminal region (ARP54663_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "INHBA Antibody - N-terminal region (ARP54663_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "INHBA Antibody - N-terminal region (ARP54663_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "INHBA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "INHBA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "INHBA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "INHBA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "INHBA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "INHBA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:INHBA Antibody - N-terminal region (ARP54663_P050)
Your Rating
We found other products you might like!