INHA Antibody - N-terminal region (ARP53597_P050)

Catalog No: ARP53597_P050

WB Suggested Anti-INHA Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Host: Rabbit
Target: INHA
Positive control (+): MCF7 (N10)
Negative control (-): THP-1 (N30)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human INHA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Goat: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 79%; Rat: 93%; Sheep: 100%; Yeast: 79%
• Peptide Sequence: Synthetic peptide located within the following region: GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-INHA (ARP53597_P050) antibody is Catalog # AAP53597 (Previous Catalog # AAPP30916)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Purdue,M.P., (2008) Cancer Res. 68 (8), 3043-3048

Target Info

• Gene Symbol: INHA
• Gene Full Name: Inhibin, alpha
• Alias Symbols: -
• NCBI Gene Id: 3623
• Protein Name: Inhibin alpha chain
• Description of Target: INHA joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. The inhibin alpha subunit joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P05111
• Protein Accession #: NP_002182
• Nucleotide Accession #: NM_002191
• Protein Size (# AA): 366
• Molecular Weight: 40 kDa
• Protein Interactions: SIAH1; TGFBR3; INHBB; INHBA; FST; ACVR2A;