Catalog No: ARP53597_P050
Price: $0.00
SKU
ARP53597_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-INHA (ARP53597_P050) antibody
Product Info
ReferencePurdue,M.P., (2008) Cancer Res. 68 (8), 3043-3048
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human INHA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 86%; Goat: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 79%; Rat: 93%; Sheep: 100%; Yeast: 79%
Peptide SequenceSynthetic peptide located within the following region: GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP
Concentration0.5 mg/ml
Blocking PeptideFor anti-INHA (ARP53597_P050) antibody is Catalog # AAP53597 (Previous Catalog # AAPP30916)
Enhanced Validation
WBY
SPR
YCHAROS
Gene SymbolINHA
Gene Full NameInhibin, alpha
Alias Symbols-
NCBI Gene Id3623
Protein NameInhibin alpha chain
Description of TargetINHA joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. The inhibin alpha subunit joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP05111
Protein Accession #NP_002182
Nucleotide Accession #NM_002191
Protein Size (# AA)366
Molecular Weight40 kDa
Protein InteractionsSIAH1; TGFBR3; INHBB; INHBA; FST; ACVR2A;
  1. What is the species homology for "INHA Antibody - N-terminal region (ARP53597_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep, Yeast".

  2. How long will it take to receive "INHA Antibody - N-terminal region (ARP53597_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "INHA Antibody - N-terminal region (ARP53597_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "INHA Antibody - N-terminal region (ARP53597_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "INHA Antibody - N-terminal region (ARP53597_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "INHA Antibody - N-terminal region (ARP53597_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "INHA Antibody - N-terminal region (ARP53597_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "INHA Antibody - N-terminal region (ARP53597_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "INHA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "INHA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "INHA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "INHA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "INHA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "INHA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:INHA Antibody - N-terminal region (ARP53597_P050)
Your Rating
We found other products you might like!