Search Antibody, Protein, and ELISA Kit Solutions

IMPA2 Antibody - C-terminal region (ARP82142_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
IMPA2
Official Gene Full Name:
inositol(myo)-1(or 4)-monophosphatase 2
NCBI Gene Id:
3613
Protein Name:
inositol monophosphatase 2
Swissprot Id:
O14732
Protein Accession #:
NP_055029.1
Nucleotide Accession #:
NM_014214.2
Description of Target:
This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder.
Protein Size (# AA):
288
Molecular Weight:
31 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IMPA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IMPA2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of Human IMPA2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: IREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-IMPA2 (ARP82142_P050) antibody is Catalog # AAP82142
Datasheets/Manuals:
Printable datasheet for anti-IMPA2 (ARP82142_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...