Catalog No: AEP10107
Size:100ug
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-ILF2 (AEP10107) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human |
Product Format | Lyophilized powder |
Application | WB |
Reconstitution and Storage | Reconstitute with distilled water. For longer periods of storage, store at -20C. Avoid repeat freeze and thaw cycles. |
Protein Sequence | VPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWD |
Tag | GST in N-terminal |
Quality Control | This product was tested on western blot. Application : Western blot standard. Observed Molecular Weight: 60 Protein Purity : 90% Expression system : Bacteria |
Gene Symbol | ILF2 |
---|---|
Alias Symbols | NF45, PRO3063 |
NCBI Gene Id | 3608 |
Description of Target | Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of the ILF2 gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression. |
Molecular Weight | 60 |
Protein Interactions | CCNDBP1; HUWE1; UBC; EEF1G; AURKA; SUMO2; SUMO3; STAU1; IVNS1ABP; RPA1; SMURF2; RPA3; RPA2; ERG; EZH2; BMI1; SUZ12; EED; rev; HNRNPU; FKBP3; DHX9; DDX1; ABCF1; C14orf166; RTCB; DIMT1; NELFB; EDC4; IGF2BP3; EIF2B2; EIF2B3; YBX3; RFC4; PTBP1; YBX1; NMT1; MR |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!