Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
ARP35731_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35731_T100-FITC Conjugated

ARP35731_T100-HRP Conjugated

ARP35731_T100-Biotin Conjugated

ILF2 Antibody - C-terminal region (ARP35731_T100)

Catalog#: ARP35731_T100
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item HPA007484
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ILF2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-ILF2 (ARP35731_T100)
Peptide Sequence Synthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ILF2 (ARP35731_T100) antibody is Catalog # AAP35731 (Previous Catalog # AAPP06977)
Datasheets/Manuals Printable datasheet for anti-ILF2 (ARP35731_T100) antibody
Sample Type Confirmation

ILF2 is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference Shin,H.J., et al., (2002) Arch. Virol. 147 (3), 471-491
Publications

Jiang, D., Zhou, Y., Moxley, R. A. & Jarrett, H. W. Purification and identification of positive regulators binding to a novel element in the c-Jun promoter. Biochemistry 47, 9318-34 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18690718

Yamauchi, T. et al. Sepantronium bromide (YM155) induces disruption of the ILF3/p54(nrb) complex, which is required for survivin expression. Biochem. Biophys. Res. Commun. 425, 711-6 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22842455

Gene Symbol ILF2
Official Gene Full Name Interleukin enhancer binding factor 2, 45kDa
Alias Symbols NF45, PRO3063
NCBI Gene Id 3608
Protein Name Interleukin enhancer-binding factor 2
Description of Target Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of the ILF2 gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression.
Swissprot Id Q12905
Protein Accession # NP_004506
Nucleotide Accession # NM_004515
Protein Size (# AA) 390
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ILF2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ILF2.
Protein Interactions CCNDBP1; HUWE1; UBC; EEF1G; AURKA; SUMO2; SUMO3; STAU1; IVNS1ABP; RPA1; SMURF2; RPA3; RPA2; ERG; EZH2; BMI1; SUZ12; EED; rev; HNRNPU; FKBP3; DHX9; DDX1; ABCF1; C14orf166; RTCB; DIMT1; NELFB; EDC4; IGF2BP3; EIF2B2; EIF2B3; YBX3; RFC4; PTBP1; YBX1; NMT1; MR
Write Your Own Review
You're reviewing:ILF2 Antibody - C-terminal region (ARP35731_T100)
Your Rating