Protein on Demand™ IL9 Recombinant Protein (Human) (OPCA23261)

Datasheets/Manuals	Printable datasheet for OPCA23261

Product Info
Predicted Species Reactivity	Human
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	19-144

Gene Full Name	interleukin 9
Alias Symbols	P40, HP40, IL-9
NCBI Gene Id	3578
Protein Name	interleukin-9
Description of Target	The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates differ
Uniprot ID	P15248
Protein Accession #	NP_000581.1
Nucleotide Accession #	NM_000590.1
Protein Size (# AA)	126