Catalog No: ARP54331_P050
Price: $0.00
SKU
ARP54331_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

IL9 Antibody - middle region (ARP54331_P050)

Datasheets/ManualsPrintable datasheet for anti-IL9 (ARP54331_P050) antibody
Product Info
ReferenceWu,B., (2008) Clin. Immunol. 126 (2), 202-210
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human IL9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 77%; Horse: 77%; Human: 100%; Rat: 83%
Peptide SequenceSynthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT
Concentration0.5 mg/ml
Blocking PeptideFor anti-IL9 (ARP54331_P050) antibody is Catalog # AAP54331 (Previous Catalog # AAPP31079)
Gene SymbolIL9
Gene Full NameInterleukin 9
Alias SymbolsP40, HP40, IL-9
NCBI Gene Id3578
Protein NameInterleukin-9
Description of TargetIL9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding IL9 has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that IL9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness. The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP15248
Protein Accession #NP_000581
Nucleotide Accession #NM_000590
Protein Size (# AA)144
Molecular Weight14kDa
Protein InteractionsSNTA1; IL9R; STAT5A;
  1. What is the species homology for "IL9 Antibody - middle region (ARP54331_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Guinea Pig, Horse".

  2. How long will it take to receive "IL9 Antibody - middle region (ARP54331_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IL9 Antibody - middle region (ARP54331_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IL9 Antibody - middle region (ARP54331_P050)"?

    This target may also be called "P40, HP40, IL-9" in publications.

  5. What is the shipping cost for "IL9 Antibody - middle region (ARP54331_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL9 Antibody - middle region (ARP54331_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL9 Antibody - middle region (ARP54331_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "14kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL9 Antibody - middle region (ARP54331_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IL9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IL9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IL9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IL9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IL9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IL9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL9 Antibody - middle region (ARP54331_P050)
Your Rating
We found other products you might like!