IL8RB Antibody - N-terminal region (ARP41956_P050)

Catalog No: ARP41956_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: IL8RB
Sample Tissue: Human PANC1 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL8RB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CXCR2 (ARP41956_P050) antibody is Catalog # AAP41956 (Previous Catalog # AAPP24492)
• Reference: Gauvreau,G.M., (2008) Am. J. Respir. Crit. Care Med. 177 (9), 952-958

Target Info

• Gene Symbol: CXCR2
• Gene Full Name: Chemokine (C-X-C motif) receptor 2
• Alias Symbols: CD182, IL8R2, IL8RA, IL8RB, CMKAR2, CDw128b
• NCBI Gene Id: 3579
• Protein Name: C-X-C chemokine receptor type 2
• Description of Target: IL8RB is the receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. IL8RB binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P25025
• Protein Accession #: NP_001548
• Nucleotide Accession #: NM_001557
• Protein Size (# AA): 360
• Molecular Weight: 41kDa
• Protein Interactions: ST13; RAB11FIP2; CXCL5; PPP2CA; MYO5B; PPBP; GNA14; RGS12; GPRASP1; CXCL1; CXCL8; CXCR1; CXCR2; GNAI3; GNAI2; GNA15; CXCL3; CXCL2; CXCL6; GRIA1; ARRB1; ADRA1A; GTF3A;