IL8 Recombinant Protein (Sheep) (OPCA00137)

Catalog No: OPCA00137

Product Info

• Predicted Species Reactivity: Ovis aries|Sheep
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : His tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP
• Protein Sequence: AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 23-101 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Sequencing of the ovine interleukin-8-encoding cDNA using the polymerase chain reaction.Legastelois I., Greenland T., Arnaud P., Mornex J.F., Cordier G.Gene 150:367-369(1994)
• Gene Symbol: CXCL8
• Gene Full Name: C-X-C motif chemokine ligand 8
• Alias Symbols: chemokine (C-X-C motif) ligand 8;C-X-C motif chemokine 8;IL8;IL-8;interleukin-8.
• NCBI Gene Id: 443418
• Protein Name: Interleukin-8
• Description of Target: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
• Uniprot ID: P36925
• Protein Size (# AA): Recombinant
• Molecular Weight: 13.1 kDa