IL5 Antibody - middle region (ARP54360_P050)

Catalog No: ARP54360_P050

WB Suggested Anti-IL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IL5 (ARP54360_P050) antibody is Catalog # AAP54360 (Previous Catalog # AAPP31135)
• Reference: Chong,L.K., (2008) Eur. J. Immunol. 38 (4), 995-1000

Target Info

• Gene Symbol: IL5
• Gene Full Name: Interleukin 5 (colony-stimulating factor, eosinophil)
• Alias Symbols: EDF, TRF, IL-5
• NCBI Gene Id: 3567
• Protein Name: Interleukin-5
• Description of Target: IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes. The protein encoded by this gene is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes. The receptor of this cytokine is a heterodimer, whose beta subunit is shared with the receptors for interleukine 3 (IL3) and colony stimulating factor 2 (CSF2/GM-CSF). This gene, together with those for interleukin 4 (IL4), interleukin 13 (IL13), and CSF2, form a cytokine gene cluster on chromosome 5. This cytokine, IL4, and IL13 are found to be regulated coordinately by long-range regulatory elements spread over 120 kilobases on chromosome 5q31. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P05113
• Protein Accession #: NP_000870
• Nucleotide Accession #: NM_000879
• Protein Size (# AA): 134
• Molecular Weight: 13kDa
• Protein Interactions: CXCL8; IL5RA; IL5; STAT5A;