Catalog No: OPCA04651
Price: $0.00
SKU
OPCA04651
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for IL4 Recombinant Protein (Crab-eating macaque) (OPCA04651) (OPCA04651) |
---|
Predicted Species Reactivity | Cynomolgus Monkey|Macaca fascicularis |
---|---|
Product Format | Liquid or Lyophilized powder |
Reconstitution and Storage | -20°C or -80°C |
Purification | Affinity purified using IMAC |
Concentration | Varies by lot. See vial for exact concentration. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
Protein Sequence | HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 25-153 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Cloning of interleukin-4 delta2 splice variant (IL-4delta2) in chimpanzee and cynomolgus macaque: phylogenetic analysis of delta2 splice variant appearance, and implications for the study of IL-4-driven immune processes.Gautherot I., Burdin N., Seguin D., Aujame L., Sodoyer R.Immunogenetics 54:635-644(2002) |
---|---|
Gene Symbol | IL4 |
Alias Symbols | B-cell stimulatory factor 1;Lymphocyte stimulatory factor 1. |
Protein Name | Interleukin-4 |
Description of Target | Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. |
Uniprot ID | P79339 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 16.9 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!